Új spamszűrő a Freemail alatt

 ( tamas.peter | 2016. július 8., péntek - 12:26 )


Tamás Péter vagyok, a Freemail termékmenedzsere.
Korábban már írtam itt a Freemail alatt működő spamszűrő részleteiről, hogy kicsit jobban belelássatok abba mi alapján kerül egy levél az inboxba / spam mappába / eldobásra. A kommentem óta sokan kerestetek meg a témában, volt hogy én, volt hogy a kollegáim segítettek kideríteni, hogy az adott levél miért nem érkezett meg / került spam mappába a Freemailen.

A Freemailen a mai napon (2016.07.08) új spamszűrőt élesítettünk, ezért a korábban írt kommentem innentől érvénytelen, az új szolgáltatás működése más, mint a Cloudmarké volt.
Mától a Vade-Retro spamszűrője működik a Freemail alatt, ami a Cloudmarkkal ellentétben egy elsősorban heurisztikákon alapuló szűrő, nem a közösség “szavazatát” tekinti minden előtt. A spam és nem spam jelentések természetesen most is számítanak, de a hangsúly a levél vizsgálatán van.

A spam- és vírusszűrésen túl a Vade-Retro alkalmas graymail detektálásra, amelyeket 3 kategóriába sorol:

  • PCE: E-mailing campaigns sent through professional routing platforms (ESP). These market players follow the rules of use for e-mail advertising: unsubscribe links, list cleaning, etc...
  • MCE: Any advertising e-mail sent and following advertising rules of use and not sent through a professional routing platform. Here the heuristic rules used are predictive and generic.
  • DCE: Any other advertising campaign not following e-mailing rules and presenting poorly organized content, non-compliance with CAN-SPAM, absence of an unsubscribe link, etc.

A DCE kategóriába eső leveleket mindenképp el fogjuk dobni, ezért tömeges levél küldésekor - ahogy eddig is - érdemes odafigyelni arra, hogy betartsátok az erre vonatkozó iparági standard elvárásokat.
A PCE, MCE kategóriák esetén figyelni fogjuk venni a spamszűrő pontozását, ez a pontszám fogja eldönteni, hogy mit kezdünk a levéllel.

Célunk, hogy a Freemailen is bevezetésre kerüljön a Gmailen, Citromailen és számos egyéb szolgáltatónál jelenleg is használatban lévő promóciós mappa, ahová a felhasználóinknak automatikusan leválogatjuk a kapott marketing leveleket.
Amint az éles, nagy adathalmazon történő vizsgálataink során beigazolódik, hogy a Vade-Retro képes erre a szelektálásra, bevezetjük ezt a funkciót. A promóciós mappába csak a legitim marketing leveleket szeretnénk látni, spam leveleket nem.

Ahogy eddig is, az adminisztratív leveleket (regisztrációs, transzakciós, visszaigazoló) mindenképp az inboxban szeretnénk látni.

Bár az élesítés előtt teszteltük a Vade-Retrot, ami alapján beállítottuk az éles induláshoz a kezdeti szabályokat, de az elkövetkezendő időszakban a látottak és a kapott feedbackek alapján biztosan fogunk még ezen több alkalommal finomítani.

Ezért arra kérlek titeket, hogy ha bármi észrevételetek lenne az új spamszűrőnkkel kapcsolatban, kérlek írjátok ezt meg nekünk (info@freemail.hu, cc:tamas.peter@origo.hu), hogy mielőbb be tudjuk állítani a szűrést egy mind a felhasználók, a tömeges küldők és az Origo szempontjából optimális állapotra.

Köszönöm és üdv,

Hozzászólás megjelenítési lehetőségek

A választott hozzászólás megjelenítési mód a „Beállítás” gombbal rögzíthető.

tömeges küldők és az Origo szempontjából optimális

Ez valószínűleg a felhasználók szempontjából nem optimális. Mert akkor ezek a kamu, de igazinak tűnő feladóval érkező herenövesztő meg agyzsugorító átbaszólevelek már rég ki lettek volna szűrve. De pl. ha magán a felületen a 2 hét alatt perfekt angolt ígérő reklám rendszeresen megjelenik, akkor valószínűleg ez nem is cél.

Szerintem sokak oromere szolgal, hogy ez itt be lett jelentve, tetszik!

"Már nem csak tehetségekből, de a hülyékből is kifogytunk..."


"Legfőbb hátránya, hogy nehéz az újratöltése, ezért ritkábban lehetett vele lőni. A számszeríj közismert páncéltörő hatása erős visszatetszést keltett a kiváló páncélokat viselő nemesség körében.

Egyet beveszel és nincs stressz többé az ágyban »

További információk »

További információk »

Itt-tö-röl het-imagát "



Marriott: Boycott Marriott Hotels for their new "Chemtrail Room"

Petition by K Jones · 542 supporters
Marriott: Boycott Marriott Hotels for their new "Chemtrail Room"
Reach the next milestone

5 days ago, you signed this petition. Help it reach 750 signatures.
Share this petition

Want to change something?
Start a petition

This email was sent by Change.org to damkosdinnye@freemail​.hu. You can edit your email preferences or unsubscribe from these emails. We'd love to hear your feedback.

Start a petition   ·   Contact us   ·   Privacy Policy
Change.org   ·   548 Market St #29993, San Francisco, CA 94104-5401, USA


"A szálloda háromcsillagos főépületében és kétcsillagos pavilonjaiban egy és két személyes, pótágyazható, légkondicionált szobák vannak tengerre vagy parkra néző erkéllyel. Rácsos gyerekágy is kérhető.

_itt_leiratk ozhat_.

A parkoló és internet használata ingyenes. Szolgáltatások: szépségszalon, fitnessz-tréning a fenyőerdőben, aperitifbár, diszkó, étterem, pizzéria, borozó, grillsütő, ajándékbolt található a szálloda területén."

A mai napig előfordul, hogy a Freemailre küldött e-maileket egyszerűen nem kapja meg a címzett. Nem a spambe kerül a levél, hanem egyszerűen nem fogadja a mailszerver/nem jeleníti meg a usernek.

Ennek tudatában nem tudom ki és miért használ Freemailt, illetve miért nem lehetett 2 évtized alatt sem javítani a hibát.

+1 És LOL hsz. És sajnos több ismerős tapasztalata szerint igaz is - részemről már évek óta - több, mint 10 már... - beszélek le mindenkit a freemail használatáról.

Phoenix Art

Én is csak azért használom, mert 18 éve regisztráltam oda.
De vicc, hogy M.O. egyik piacvezető webáruházból írnak nekem, hogy nem tudnak zöldágra vergődni a freemailesekkel (pedig oda valóban feliratkoztam), így jobb lenne, ha más email címet adnék meg, de pl. az úgysemveszlekmegsoha.hu spammer szemetek, és a csak 1 tabl.etta/al.kalom stílusú átbaszólevelek mind célbaérnek. Bár valószínű ezek fizetnek az origónak, hogy ne szűrjék őket. Mondjuk nem izgat, mert érdekes módon az otthoni spamszűrőm képes rá, hogy ezeket kikukázza.

ha ez vigasztal, a citromail-es cimeket se szoktak szeretni a webaruhazak. Volt egy citromos afferom, amikor probaltam elerni naluk, hogy vegyek mar fel a relay szereveket egy olyan (feher)listara, ami a valami gagyi rbl elott van. Es a kisgyerek megmagyarazta, hogy nem lehet [muszakilag]. Jol van, hulye vagy b+.

"nem tárgyszerűen nézem a dolgot, hanem a vádló szerepéből. Sok bosszúságot okoztak, örülnék ha megbüntetnék őket - tudom gyarló dolog, de hát nem vagyok tökéletes." (BehringerZoltan)

Gondolom lett volna az a pénz, amiért műszakilag megoldható. Mert nem hiszem el, hogy a spammerek nem fizetnek nekik.

Sok helyen regisztrációnál ki van írva, hogy freemailt, citromailt és vipmailt NE.
Mi és, és ügyfelek is rendszeresen tapasztalnak vele problémákat, mind bejövő, mind kimenő leveleknél.
The Community ENTerprise Operating System

mondjuk ez ugy lenne szep, ha nem a hupon lenne az ugyfelszolgalat, hanem lenne egy wiki.freemail.hu, ahol le lenne irva, hogy mennek a dolgok a freemail.hu halozatan. Lenne egy a leggyakrabban elofordulo kerdesek rovat is. A wiki formatum azert lenne jo, mert akkor user kommentek is szinesithetnek a doksit a'la feedback. Esetleg lenne az oldal jobb also sarkaban egy "hello, Bela vagyok, csetelunk?" ablak, ahol akar ai-val, akar humanoiddal lehet beszelgetni a problemarol. Bar, gondolom, orulunk, hogy meg egyben van a cucc az alig van ra ember felallassal...

"nem tárgyszerűen nézem a dolgot, hanem a vádló szerepéből. Sok bosszúságot okoztak, örülnék ha megbüntetnék őket - tudom gyarló dolog, de hát nem vagyok tökéletes." (BehringerZoltan)

Valszin át is kéne nevezni paidmail.hu -ra. :)

Ez még mindég létezik? Romjait sóval beszórni.

Epelmeju ember nem hasznal freemailt bar spamtrap-nek kivalo :D

Szép és jó.. de amúgy késő. Én akkor rágtam be freemailre, amikor 10 nappal később léptem be, mint ami náluk elő van írva és törölték a régi emaileket (mindet). Azóta egy okosító forumon megtudtam, hogy ha van egy forward emailcím beállítva, akkor soha nem törlik a leveleket. Undocumented feature. Azóta sem lépek be. megy minden gmailre. Ott nem törölnek...
Amúgy meg elég random volt a kézbesítési idő, ahogy mások is írják...
Ez a spamszűrő még ha működik is, eső után köpönyeg.... sokmindent át kellene gondolni freemailen... kb 8 éve nem lépek be rendszeresen. Már csak failovernek tartom, ha valahova véletlenül oda lennék még beregisztrálva...

van ra esely, hogy ahogyan az iwiw eltunt a sullyesztoben, a freemail is erre a sorsra jut. Bar az origo nyilvan a vegso leheleteig kuzd erte, de ha mar nem lehet a hirdetoket meggyozni, hogy csillio user aktivan hasznalja (=nezik a reklamokat), akkor meg vannak szamlalva a freemail napjai. Bar, csak halkan jegyzem meg, hogy az origo tavalyi (khmm) "atszervezese" utan magara az origora sem tennek nagy penzzel, hogy meg sokaig velunk marad...

"nem tárgyszerűen nézem a dolgot, hanem a vádló szerepéből. Sok bosszúságot okoztak, örülnék ha megbüntetnék őket - tudom gyarló dolog, de hát nem vagyok tökéletes." (BehringerZoltan)

Hát, nekem csak historikus okokból van meg az ottani címem, csak a spamet gyűjti. Valószínűleg ugyanazok vagy ugyanazzal a technikával kerülték ki a spamszűrőt, mert jellemzően nem ismerik az unicode-ot a feladó és tárgy mezőben a spamjeik. Már azt hittem, hogy csak egy ottfelejtett szerver szolgáltatja, mint anno a nexus-os címeket :)

Meglátjuk, hogy hoz-e változást az új szűrő.

Oszinten szeretnek gratulalni ehhez, egyben jeleznem, hogy ez mar a sokadik probalkozasotok volt, ahol epp a legitim levelekre dobtok 550 -et.
Pl most a hibajelentesemet is :)

"This message was created automatically by mail delivery software.

A message that you sent could not be delivered to one or more of its
recipients. This is a permanent error. The following address(es) failed:

SMTP error from remote mail server after end of data:
host fmx.freemail.hu []: 550 5.7.1 message content rejected

Kene mar naluk egy bejelento alkalmazas ahol el lehet oket erni. Amig ez nincs meg addig en bannolom oket mindenhol ahova a kezem eler...

En nem teszek ilyet :) Eleg, ha fogadjak a leveleket, mint eddig. Ha ez nem sikerul, akkor azt kell, hogy kommunikaljuk a kozos ugyfeleink iranyaba, ami a valosag, azaz hogy nem fogadjak a leveleket es mivel valaszt nem kapunk a szolgaltatotol, fordulhatnak ok is ebbe az iranyba.
Nem 10 emberrol van szo. Felteszem, mitobb, remelem, hogy mindenkinek a megoldas az erdeke.

En hosszu evekig szenvedtem veluk (mindezt ugy hogy volt hatszelem mert a T-nel dolgoztam) en nem az a fajta vagyok hogy elottem van egy fal es ha mindig beverem a fejem akkor bukosisakot veszek fel hanem inkabb megkerulom.

Webes szolgaltatasoknal Magyarorszagon max 72 oran belul minden megkeresesre valaszolni kell, igy ha lenne is oka a tiltasnak a reszunkrol -ami nincs- akkor sem tehetnenk meg. Kozos ugyfelek vannak, maganemberek, akik egyikunktol-masikunktol nem kapnak meg leveleket. Es oket altalaban ez erdekli. Mas kerdes, hogy mar a masodik spamszűrőcsere van, amibe mi, mint legitim levélküldők futunk bele. Most eppen mar ugy, hogy a topicindito altal megadott cimek egyikere nem is tudunk kuldeni meg egy nyomorult hibajelentest sem.

A HUP-os hírlevél a freemail-es postafiókomba érkezik évek óta.
A mostani váltás óta a SPAM könyvtárba kerül, noha bejelöltem, hogy nem-spam.

Ehhez képest valód spam-ek vígan vihognak a beérkezett levele között :-(

Ráadásul az egyik freemail-es fiókom hetek óta nem működik,
a működőbe meg nekem is ömlik újra a spam. :(

Végre azok a levelek, amik kéretlennek lettek jelölve,legközelebb már nem a beérkezett levelek közé, hanem a SPAM mappában landolnak.

Szia Peti.
Nem tudom mit állítottatok a rendszeren, de pl ma kb 30 partnerünk nem kapta meg az aktuális árjegyzékét, pedig fel vannak íratkozva rá, mert vissza kell jelezniük, hogy elfogadják e vagy nem. Erre fel ez érkezik vissza:
******a@freemail.hu>: host fmx.freemail.hu[] said: 550 5.7.1
Message denied by policy. Cause:
(in reply to end of DATA command)

Vade Retro 01.392.46#41 AS+AV+AP Profile: VRUnsubscribe, FREEMAIL; Bailout: 300; ^SpamIpNetwork (150)

Kell a kapacitas a SPAM-ek kezbesitesere. Ugyfeleidnek magyarazd el hogy valasszanak mail szolgaltatot...


Annyira gyulolod a BlackPanthert!
En meg ezert gyullolek! NIncs ra szo!
Le se szarlak! Erted budos goreny?!
(abalole, a 20062. user)

Ugyanez nálunk is.
Szabad tudni hogy milyen szolgáltatónál van a gép?

Lehet ugyanannál, a SpamIpNetworkből tippelve.

Írj ilyet, azt nem dobják el:

Meleg Telen 20000 forintert minosegi LANCFURESZT kapsz

A röhej, hogy a feladónak még az MX-e sem létezik, és ezt nem képesek alapból, mindenféle csodaspamszűrő nélkül kidobni.

Mert nem is akarjak ;)

Nincs ra esszeru magyarazat mert az efele leveleket gyok ketto pistike is eldobja csak az hogy ezert penzt kapnak.

Szia Peti!

Ugyanilyen a hibaüzenet, egy freemailről érkezett levélre próbáltam válaszolni. A "Cause:" után nem lehetne emberi nyelven tudatni a probléma okát? Így urukhájk-ul kicsit érthetetlen.


Vade Retro 01.392.51#125 AS+AV+AP Profile: VRUnsubscribe, FREEMAIL; Bailout: 300; ^SpamIp (300)

Ettől se lettem okosabb, de köszönöm a helpet, erre nem gondoltam:)!

Biztos spammer vagy :P Valamiért innen simán elmegy pedig most épp PBL-en van a szerver.
(Évente egyszer le kell jelenteni, mert az ISP-nek sokadik kérésre se sikerült átvariálni a tartományt statikusra, bezzeg a ténylegesen dinamikus tartományuk nincs PBL-en :))

Az a tippem, hogy a freemail-nel vegignezik az osszes Received headert, es ha az ott szereplo IP cimek kozott van olyan, ami szerepel valamelyik RBL-ben, akkor eldobjak a levelet.

Onnan gondolom, mert csak azota panaszkodnak a juzerek, amiota a netqmail beleteszi a fejlecbe, hogy milyen IP cimrol kapja a (bejelentkezett, letezo, ervenyes, stb.) juzertol a levelet:

Received: from juzer-otthoni-gepe.internetszolgaltato.hu (HELO (juzer@
  by mail.cegnev.hu with ESMTPA; 17 Oct 2016 15:53:58 -0000

Némi kétkedéssel olvasom az itt leírtakat, mivel a folyószámla kivonatok tartalmában kevés spam gyanúsat tudnék találni (épp ésszel), már eltekintve a senki által nem érthető nyelv (magyar, tán ilyen nincs is csak a Star Wars univerzumban). Nem beszélve a semmit mondó hibaüzenetről.

Szóval a cég névválasztása mindent visz, de talán kicsit többet lehetne dolgozni a szűrő heurisztikáján.

De hogy hozzá is tegyek, ne csak elvegyek:
Olvassatok logot, minden nap, akár több órán át is. Mik azok a domainek, IP -k ahonnan nagy mennyiségben utasítotok el emailt. Tudom fáradtságos munka de nem szeretnénk mi mindnyájan (akik a hup -on megjelenünk és levelezést üzemeltetünk), helyettetek elvégezni.


Hjam a freemailesek arrol hiresek hogy logot olvasnak :D

Valahol csak el kell kezdeni ;)


2016 október óta nincs új hozzászólás.
Ez azt jelenti, hogy mindenkinél megoldódott a probléma (csak engem szivat a freemail?) vagy azt, hogy egyszerűen feladtátok? :-)

A webáruházunk folyamatosan kapja vissza a hibaüzeneteket. Nincs megoldás?

Egy időben (tavalyi év második felében) ömlött a spam a freemail fiókomba. Egy ideje semmi spam nem jön. Most leteszteltem, küldtem rá tesztlevelet. Megérkezett. Nekem ebből annyi jön le, hogy jobb lett, mint volt.

trey @ gépház

Ez nagyszerű hír! :-)
A saját privát email címedről küldted vagy valami céges/nyilvános címről?
(Lehet, hogy nem mindegy!)

Harmadik. A saját gépemről küldtem egy MUA-val, a mail.t-online.hu-n keresztül, egy, a céges e-mail címemmel létrehozott fiókból. Gyengébb idegzetű spamszűrők ha ki nem is dobják ezt, azért már néha [BULK]-ra taggelik.

De ez átment, viszont spamot nem kapok. Úgyhogy szerintem az irány egyelőre jó.

trey @ gépház

Egy hete levelezek velük, hogy visszautasítják a céges leveleket.
Reagálnak, segítőkészek, de még mindig gond van.

Reagálnak? Segítőkészek?? :-O

Na akkor én is megpróbálom (újra)!

.eml formátumban kérték a visszautasított levelet és az elutasítás okát, azaz a visszakapott levél tartalmát.
Talán egy kört meg lehet spórolni, ha rögtön csatolod.

Most próbáltam saját, nem-céges domain-ről küldeni egy frissen aktivált (sokáig nem használt) freemail-es postafiókba küldeni. Csak greylisting volt, de utána sikeresen fogadták a levelet.

Reagálnak, segítőkészek, de még mindig gond van

mert a fentibol mindig csak 2-t valaszthatsz :D

Nekem határozottan javult. A POP3 letöltés viszont lassult rendesen.


Valami FM probléma lesz itt kérem szépen! Ma (2017.01.10.) óta egy nem-spamlistán lévő szervertől a sima text e-mailt csatolmány nélkül, nem spam-listán lévő feladótól (+van dkim és spf is elvileg) nem veszi át a freemail a szokásos:

host fmx.freemail.hu []
SMTP error from remote mail server after end of data:
550 5.7.1 Message denied by policy


Utána jön ez a base64-es rész:"gggruggvucftvghtrhhoucdtuddrfeelgedrvdeigdelvdcutefuodetggdotefrucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpucfhtffggffotefknfenuceurghilhhouhhtmecufedttdenucgoufhprghmkfhpucdlfedttddmnecujfgurhephfffkffuvfgtgfesthhqredttddtjeenucfhrhhomhepifgvrhhgvghlhicuvfhothhhuceomhgrihhlsegsrghjvhgrnhdrhhhuqeenucfkphepudejkedrvdefkedrvddvvddrudejnecurfgrrhgrmhephhgvlhhopeifsgdujedrtghpshgvrhhvvghrrdhnvghtpdhinhgvthepudejkedrvdefkedrvddvvddrudejpdhmrghilhhfrhhomhepmhgrihhlsegsrghjvhgrnhdrhhhupdhrtghpthhtohephhgvrhgvphgvhidrughrsehfrhgvvghmrghilhdrhhhu"

Korábban írta valaki, hogy https://www.base64decode.org/, de nekem nem sikerül dekódolni. Mit rontok el? Biztos valami szintaktika csak. Meg milyen kódolást kéne beállítani, hogy ezt meg tudjam fejteni?

Ami a gyanús, hogy náluk van a gond, hogy október óta csend volt és ma (jan10) több új hozzászólás is született. Ekkora véletlenek nincsenek. :)


Igen, én melegítettem fel a témát..
És valóban nem véletlenül!
De nekem nem ma kezdte a megnövekedett visszadobálást a freemail, hanem kb jan 4-től!
(A hibaüzenet dekódolás nekem sem megy, de azt hittem én vagyok béna..) :-o

Fentebb linkeltem, hogy lehet visszafejteni.

Ja igen, köszönöm!
- - - - - - -
Már újabb kódolást használnak:

- - - - - - -
(Bár a dekódolás ettől nem oldódott meg. Vagy csak nem találom?)

Most telefonról netezek, de szerintem benne van.
Fel kellett tenni valami csomagot. Remélem jót linkeltem.

Erre keressél ra:

Nekem is érezhetően javult csak el ne kiabáljam, tarcsinak nem rossz

Mint email kliens lehet, hogy használható lett, de én most a másik oldalról nézem!
OK, nem kapsz rá spam-et...
Viszont nem tudhatod, hogy még milyen (esetleg fontos) e-mail nem érkezik meg, mert a Freemail visszautasítja! :-(

Szerver oldalrol mar reg kuka. Ekkora foshalmaz "mail" szolgaltato nincs megegy a foldon.

Nálam még mindig landolnak a szexelni akaró hölgyek ajánlatai. (Egyet emlékbe megtartottam, ami a nejem lánykori nevében jött. :-) )

Eddig legalább base64-ben kódolták a hibaüzenetet, de most valami nagyon érdekes kódolást használnak

szundik írta:
[...]de most valami nagyon érdekes kódolást használnak

Ahogy azt fentebb már írták, kétszer is.

Azon a linken ok, hogy ott van, amit ők használnak, de ettől még dekódolni nem tudom a hibaüzit. Ehhez nincs valami online dekóder? Az "átlagnak" értelmezhetetlen hibaüzinek marha sok értelme van amúgy... :-/

Pl nem akarjak segíteni a spamereket. Valószínűleg ezért változtattak.
1 perc feltenni amire szükség van.

Akkor a spammereknek is 1 perc feltenni. Nem telepítenék csak ezért *vaderetro*-t

Nem is kell az egészet feltenni.
Ahogy te sem tudtad mi az, lehet a spammerek sem. Valószínűleg nem is orulnek neki, hogy megosztottam a linket, mert saját használatra van, hogy könnyebb legyen a panaszos levelek vizsgálata.

Engem érdekelt, rakerestem, feltettem egy virtuális gepre.

Ennyi erovel ne is irjak ki miert nem fogadnak levelet? Nem kicsit huJe allaspont ez nem gondolod?

Úgy tűnik, hogy továbbra is szükségük van a felhasználóik adataira, ezért elkezdtek fejlődni. Érezhető a javulás, a sok probléma ellenére is.
Szerintem korrekt amit csinálnak. Kezdetben adtak egyértelmű visszajelzést, aztán már csak saját elemzéshez akarják használni.
Senki nem szokta megadni a spamszűrő értékelését, mert kb értelmét is vesztené a spamszűrő.

Ja, csak kicsit most "túl van tekerve". Szerintem pl. ha egy magyar IP-jű, blacklisten nem szereplő, SPF-es + DKIM-es e-mail címről nem vesz át egy csatolmányt nem tartalmazó levelet, akkor ott valami nem ok... Hosting cég szétteszi a kezét, hogy "náluk minden ok", Freemail support nyilván nem létezik (??), én meg nem tudok levelet küldeni az X százezer Freemail-es usernek...

Igen, "túl van tekerve". Ezért írtam nekik én is.

-ra írt levelemre másfél óra után válaszoltak!
De ez a szál arról szól, hogy miért nem akarják kiadni, hogy az egyes leveleket mire pontozta ki a spamszűrő.

Egyébként lehet most kéne összefogni, és elmagyarázni az ismerősöknek, ügyfeleknek,..., miért lenne neki érdemes szolgáltatót váltani (megszabadulni az összes @t-online.hu, @upc.hu, @citromail.hu, ... címektől), és hogy nem kell parázni, át lehet irányítani (le lehet kérni az új szolgáltatónál) a leveleket arra az időre, míg átszoknak a levelezőpartnerek.

es dkim-mel ala is irod a kimeno leveleidet, vagy csak ugy benne van a dns-ben?

Saying a programming language is good because it works on all platforms is like saying anal sex is good because it works on all genders....


Ezt hogy kell értelmezni? :))

An error occurred while trying to deliver the mail to the following recipients:

Action: failed
Final-Recipient: rfc822;

Diagnostic-Code: smtp; 550 5.7.1 Message denied by policy. gggruggvucftvghtrhhoucdtuddrfeelkedrudeggddugeefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpucfhtffggffotefknfenuceurghilhhouhhtmecufedttdenucgoufhprghmkfhpucdlfedttddmnecujfgurhepfffvhfhruffkofggtgfgsegrkeerphertdejnecuhfhrohhmpefjohhsthhinhhgheehuceohhhoshhtihhngheshhhoshhtihhnghehhedrtghomheqnecuffhomhgrihhnpehhohhsthhinhhgheehrdhhuhdphhhoshhtihhnghehhedrtghomhdpfhhoghhghihoghihrghsiidrtghomhenucfkphepheegrddvgedtrdekrdehleenucfrrghrrghmpehhvghloheprgekqdehledrshhmthhpqdhouhhtrdgrmhgriihonhhsvghsrdgtohhmpdhinhgvthepheegrddvgedtrdekrdehledpmhgrihhlfhhrohhmpedtuddttddtudehugdtfheftdelledvvddqsgeltdgsfedttdgtqddurgdvhedqgegtgedtqdellegufedqfhdvjeegkegrfhgskegtudehqddttddttddttdesrghmrgiiohhnshgvshdrtghomhdprhgtphhtthhopegrnhhgvghlkhgrthhhhiesfhhrvggvmhgrihhlrdhhuh
Status: 5.7.1

lol :)
lehet telefonon kell bediktalni ezt a kodot a supportnak :)

most én is találkoztam ezzel, jó lenne valami admin friendly üzenetet is küldene

A jelenség jelentkezésekor még volt, csak azóta gondolom annyi fórumon húzták le azt az üzenetet (ami dióhályban arról tájékoztatott, hogy a mi istenkirály spam szűrönk szerint te kb@s..t spamer vagy, ha meg mégse, akkor ne velünk vitázz, hanem menj a domain tulajdonosához) a diagnostic code -ban az egy base64 string, amiben egy bináris lópikula van, ami vélhetőleg titkosítva tartalmazza az üzenetet.

Egyébként a Spam szúrő "szolgáltatót"/software -t Vade Retro -nak hívják, eléggé rejtőzködő társaság

Elég sok bajom volt velük. Szerintem egyébként nem bayesian probability "típusú" szűrőjuk lehet, inkábcsak frequency, vagy hasonló. Mivel volt olyan, hogy teljesen legitim levélből átment a freemail -re 200, a 201 -be pedig bele végta a baltát (néhány bővített mondat, meg egy PDF melléklet: folyószámla kivonat).


csak annyi a gond, hogy a feleségem céges levelezése megy a gépről(saját domain), minimál levél forgalom, noBL, értelmes levelek, SPF, DKIM belőve, erre ez fogad, hogy a freemail ilyen f*szom üzenettel akkor nem kézbesíti a levelet, vicc

Néhány napja dobott el O365-ös levelet is nekem, gondolom onnan is túl sok e-mail jött.

Kb annyit tudsz tenne, hogy írsz a freemail -nek (OFF hogy basszák meg a spam szűrőjüket /OFF), ne felejtsd el mellékelni az eredeti és a válaszul kapott levelet. Aztán ők majd felírnak a jófiúk közé.

Egész véletlen nem használod smart hosztnak a T, vagy a UPC levelező serverét?


soha nem volt smarthost , denineten van a gép

Ja akkor nincs is több kérdésem...
Akkor ott a megoldás


Nyehehehehe... :-D

Én is pont ma vettem észre hogy beszoptam ezt. Van egy levlistám 6-8 freemailes taggal (is), és elkezdtek sírni hogy nem kapnak levelet. Ok, az elkódolt izét nem lehet visszafejteni, írtátok is. No akkor nézzük a freemail.hu -t, hátha van ott info, contact cím: nem megy, karbantartás.

Nézem tovább a logot, vannak még vidám dolgok benne, ez pl csak amolyan fun fact:

2017-08-03 19:51:03 1ddKGx-000NaB-5E [] SSL verify error: depth=0 error=certificate has expired cert=/C=HU/ST=Budapest/L=Budapest/O=Origo Zrt./CN=*.freemail.hu

Jólvan ne pofozzuk a szart, írok a listatagoknak magánban, hogy amennyiben nem akarnak a továbbiakban egy kő alatt élni, menjenek már el normális szolgáltatóhoz, de hiába a próbálkozás: a freemail SMTP-i nem mennek perpill. Mindegy, majd megkapják reggel (vagy 1-2 hét múlva, de gondolom amúgy is hozzá vannak szokva az ilyesmihez, és szeretik így is, mert a postánál azért csak olcsóbb a dolog!).

Node a spamfilter miatt írok azért Péternek is, aki a threadet indította, hátha tud segíteni, ott a postban a címe:

SMTP error from remote mail server after RCPT TO:: 550-5.1.1 The email account that you tried to reach does not exist.

Ezen a ponton feladtam :)

Biztos nagyon este van, de nekem úgy tűnik, hogy az a certificate még nem járt le:
Not Before: Jan 10 00:00:00 2017 GMT
Not After : Mar 23 12:00:00 2018 GMT

Egyébként ha jól látom, azt kérte, hogy az info@-ra írj (CC ő).
A linkedinen rákeresve pedig kiderül, hogy már nem dolgozik ott (https://www.linkedin.com/in/p%C3%A9ter-tam%C3%A1s-30404a115/). Van ilyen, az emberek néha munkahelyet váltanak.
Szóval ha jól értem, neked továbbra is az

-n kellene próbálkoznod. Én már volt, hogy írtam, és tudtak segíteni. :)


Origós címet keressetek az info@ -ra pont úgy nem mennek el a levelek,ha be listáztak


Persze, láttam a másik címet is, de az smtp-jük sem ment amikor írtam. Igazából csak vázolni akartam a tegnap esti helyzetet a leírtakkal :) Pedig nem történt semmi különös, csak random időpontban ránéztem a Freemailre egy régebb óta meglevő problémám miatt (az említett levlistás dolog már júliusba is adott volt nálam, csak nem vettem észre mert nem sírtak).

A CERT most(!) tényleg jó! Elég érdekes, lehet hogy valaki olvassa ezt a threadet tőlük?

Az utolsó olyan kapcsolódás nálam amikor jó volt a CERT még februárban volt:

main-20170215.log:2017-02-15 15:04:09 1cdzTv-0001wG-VF -> ******@freemail.hu R=dnslookup T=remote_smtp H=fmx.freemail.hu [] X=TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256 CV=yes DN="/C=HU/ST=Budapest/L=Budapest/O=Origo Zrt./CN=*.freemail.hu" C="250 2.0.0 Ok: queued as 3vNgxz02xGz9sp"

1 nappal később:

main-20170216.log:2017-02-16 16:11:39 1ceNiX-000Enk-QH [] SSL verify error: depth=0 error=certificate has expired cert=/C=HU/ST=Budapest/L=Budapest/O=Origo Zrt./CN=*.freemail.hu

Azóta ez ment egészen ma reggelig. Véletlen?

Lehet hogy visszaálltak valami régebbi snapshotra, mert a cert ismét le van járva, a leveleket pedig átveszi (olyanokat amiket eddig nem) :)

# openssl s_client -connect fmx.freemail.hu:25 -starttls smtp
depth=2 C = US, O = DigiCert Inc, OU = www.digicert.com, CN = DigiCert High Assurance EV Root CA
verify return:1
depth=1 C = US, O = DigiCert Inc, OU = www.digicert.com, CN = DigiCert SHA2 High Assurance Server CA
verify return:1
depth=0 C = HU, ST = Budapest, L = Budapest, O = Origo Zrt., CN = *.freemail.hu
verify error:num=10:certificate has expired


Van valami most ezzel az "új spam szűrővel"? Az utóbbi három napban panaszkodnak az ügyfelek, hogy minden visszapattan a freemailről. Ez idő alatt 250 levelet próbáltak küldeni az ügyfelek, egy sem ért célba és sajnos csak a szokásos kódolt hibaüzenet jön vissza.
Napi átlag 80-100 üzenet megy ki ügyfeleinktől freemailre, átnéztem az utóbbi heteket, nem volt spammelés vagy hírlevél típusú levél feléjük, csak sima privát levelezés.

DKIM, SPF-ek rendben, szerver sosem volt listázva semmilyen blacklisten.

Miért nem nekik írsz? Ez itt nem a product support oldaluk, legfeljebb elfüstölöghetsz a problémán, segíteni ők tudnak neked.


Sose értettem azokat a usereket, akik fremailt használnak még a mai napig. Anno még menő volt amikor az első cimet regelte be az ember, de ma már én egyfajta undorral tekintek a freemailes cimekre, pont emiatt, hogy sose tudod a "Küldés" gomb megnyomásakor, hogy a leveled valaha is célba ér-e, vagy ha oda is ér nem egy irreleváns hibaüzenettel pattan vissza...
Dropbox refer - mert kell a hely: https://db.tt/V3RtXWLl
neut @ présház



Számítástechnikai tippek, trükkök, leírások - Linux ● macOS ● Windows

Írtam volna sógornőmnek, fontos infó (hozzá rendeltem valamit ajándékba), illetve anyám írt volna a keresztfia feleségének, nyilván nem spam, rendes levél, szöveg, tárgy, az egyikben include-olt levél gmailről, csatolva semmi, és ilyen kedves és abszolút semmitmondó vacak jön vissza a freemailről:


Üzenet letiltva

e-mail-címre küldött üzenetét letiltották. További információért tekintse meg az alábbi technikai részleteket.
A távoli szerver válasza:

550 5.7.1 Message denied by policy. gggruggvucftvghtrhhoucdtuddrgedttddrieeggdduudehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpucfhtffggffotefknfenuceurghilhhouhhtmecufedttdenuceurggutfgvphhuthdqgfhmrghiulddutdejmdenucfjughrpefhfffkufgesrgdtreertddtjeenucfhrhhomhepfdfrvghrvghsiihlvgdknhihihcuifgrkdgsohhrfdcuoehpvghrvghsiiesghhmrghilhdrtghomheqnecuffhomhgrihhnpehsphhrihhnthgvrhdrhhhupdhgohhoghhlvgdrtghomhdpghhkihguihhgihhtrghlrdhhuhenucfkphepvddtledrkeehrddvvddtrddujeegnecurfgrrhgrmhephhgvlhhopehmrghilhdqqhhktddqfhdujeegrdhgohhoghhlvgdrtghomhdpihhnvghtpedvtdelrdekhedrvddvtddrudejgemhgrihhlfhhrohhmpehpvghrvghsiiesghhilhdrtghomhdprhgtphhtthhopehhkhhmrghrthhisehfrhgvvghmrghilhdrhhhunecuvehluhhsthgvrhfuihiivgeptd

Final-Recipient: rfc822;

Action: failed
Status: 5.7.1
Remote-MTA: dns; fmx.freemail.hu. (, the server for the domain freemail.hu.)
Diagnostic-Code: smtp; 550 5.7.1 Message denied by policy. gggruggvucfthtrhhoucdtuddrgedttddrieeggdduudehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpucfhtffggffotefknfenuceurlhhouhhtmecufedttdenuceurggutfgvphhutgfhmrghiulddutdejmdenucfjughrpefhfffkuffvtgesrgdtreertddtjeenucfhrhhomhepfdfrvghrvghsiihlvgdknhihihcuifgrkdgsohhrfdcuoehpvghrvghsiiesghhmrghilhdrtghomheqnecuffhomhgrihhnpehsphhrihhnthgvrhdrhhhupdhgohhoghhlvgdrtghomhdpghhguihhgihhtrghlrdhhuhenucfkphepvddtledrkeehrddvvddtrdduegnecurfgrrhgrmhephhgvlhhopehmrghilhdqqhhktddqfhdujeegrdhgohhoghhlvgdrtghomhdpihhnvghtpedvtdelrdekhedrvddvtddrudejgedpmhgrihhlfhhrohhmpehpvghrvghsiiesghhmrghilhdrtghomhdprhgtthhopehhkhhmrghrthhisehfrhgvvghmrghilhdrhhhunecuvehluhhsthgvrhfuihiivgeptd
Last-Attempt-Date: Fri, 10 Nov 2017 23:41:29 -0800 (PST)


Ebből egy átlag felhasználónak annyi jön el, hogy a freemailre nem lehet levelet küldeni.

(Az, hogy a freemail sz@r, az nem újdonság, de hogy még lehet fokozni, az azért nem semmi.)

fogd fel ugy, hogy ez mar muveszet. Vagy egy foldonkivuli civilizacio probal veled kapcsolatba kerulni. Meg ahogy mondani szokas, 1 kep tobbet er ezer szonal:


t-systems-es it architect allast keres. Jelige: csak webshopot ne kelljen...

Lol, ez pont olyan, mintha valaki rátenyerelt volna a billentyűzetre...
"Sose a gép a hülye."

Pár perccel ezelőtt én is pontosan így jártam (első blikkre a gggruggvucftvghtrhhoucdtuddrgedtuddrvdeg... is ugyanaz). Írtam az info-s címre is, és a tamas.peter-re is - utóbbi már nem él, előbbiről egy automatikus válaszüzenet jött (nem, nem "Message denied by policy" tartalommal :) ).

gmail-ről továbbított leveleket újabban nem fogad a freemail. Vajon mit árt nekik?

Hogy értve továbbított? Továbbítás gombbal vagy automatikusan?

Gondolom, kb. annyit, mint az én levelem :)

Próbáld meg a postmaster@ címet is, az eredeti levéllel, meg a visszautasítás részleteivel. Nekem segített.

Van reakció, a spamszűrő társaság válasza: It's a false positive on ip address XXX.XXX.XXX.XXX, a fix will be available in the
next release of the VadeSecure filter
. Remélhetőleg, rendben lesz.

Igen, hozzájuk is bejelentheted közvetlenül a visszakapott azonosítóval, de ezt itt már le sem mertem írni. :)

Majd 400 ügyfélnek nem tudunk levelet küldeni, mert visszajön ezzel az üzenettel. 5-6 hónapja ez van.

Mi anno arra futottunk rá, hogy ha adott domain szerepelt bárhol! (igen, tokkal-vonóval fejléccel mindennel...) az emailben, akkor jött a rejected after data. Könnyen lehet, hogy hasonló a probléma.

Aki velem kapcsolatba kerül, (ügyfelemmé válik) és véletlen freemail-es fiókja van, az záros határidőn belül le fogja cserélni bármi másra. Citromot se tolerálom.
Nem elég, hogy néha szívatom saját magam a hülyeségeimmel, de hogy ezt még más is megtegye na neeee… magamnak is napokig tart megbocsátani 1-1 félregépelés miatt. (pl ha MTA- t túrok) :D