Freemail visszadobja a levelet

 ( yoursoft | 2017. november 26., vasárnap - 11:58 )

Több helyen próbáltam, többféle VPS-t és az egyiknél ilyen hibaüzenetet kapok, ha freemail-ra szeretnék küldeni emailt:

echo "tesztelek" | mail -s "teszt"

Nov 26 10:47:52 dictzone sm-mta[1653]: vAQ9IRQX000649: to=, ctladdr= (1000/1000), delay=00:29:25, xdelay=00:00:00, mailer=esmtp, pri=4
80296,, dsn=4.0.0, stat=Deferred: 450 4.7.1 Client host rejected: cannot find your reverse hostname, [ip cím]

gmailra kimegy simán. Volt ahol volt valamiféle szolgáltatói dns név. Volt ahol ez sem volt, mégis ment (aruba).

Nem szeretném ráirányítani pl. a domaint erre a szerverre. Van más megoldás?

Hozzászólás megjelenítési lehetőségek

A választott hozzászólás megjelenítési mód a „Beállítás” gombbal rögzíthető.

PTR/reverz nélkül ne levelezz, szóval legyen akarmi.domain ami az IP-re mutat és ugyanezt vedd fel az IP-n is PTR-nek. Ugyanígy erősen ajánlott az SPF rekordok minimális karbantartása is, ha nem akarsz spamfolderben landolni vagy rossz esetben visszapattanni.

Köszi. Néztem, de a CloudFlare dns-ében nem tudtam ezt beállítani. A kimenő SMTP pedig tiltott a VPS-en.

Nem is ott kell, hanem a VPS szolgáltatónál. Ha a kimenő SMTP tiltott, akkor, hogyan jutsz el a freemailig?

Azt nem tudom, hogyan megy ki a gmailra és hogyan jut el ennek a tiltásnak az ellenére a freemail-ig. :-)

Viszont most a Te útmutatásod alapján sikerült és működik! :-)

Mennyi levelet küldesz naponta? Mert ha napi 500 alatt van, akkor tudod használni ingyen a Google SMTP-t (a saját adataiddal hitelesítve), mint relay host és akkor nincs ilyen gond. Ha több, mint 500 levelet küldenél naponta, akkor is lehet használni, business előfizetéssel ($5 havonta) már 2500 levelet tudsz küldeni naponta. Ha ez is kevés, akkor a kvóta felett pár gombot fizetni (SendGrid).

A baj az, hogy VPS-ről soha nem fogsz tudni olyan megbízhatóan leveleket küldeni, mint egy rendes SMTP hosztról, mert kaphatsz olyan IP-t, ami rajta van a blacklist-en itt-ott, vagy vannak szolgáltatók, akik alapból tiltják a teljes VPS hálózati tartományt.

Köszi, olyan 400 levelet küldök.
Tehát ez jó megoldás lehet. :-)

Köszi, de lassú volt. :-(
Így mivel a felhasználóknak is adok visszajelzést a sikerességről így ezt elvetettem. :-(

Mi volt lassú?

Amíg kiment a levél. A felületen nem tudom megmondani mennyit. De kb. 2-3 sec-el többet is várni kellett, mint a másik megoldásnál.

Hát... ha valahol greylisting van, akkor a saját megoldásod 5-10 perceket fog várni, ha meg komolyabb spam szűrés, akkor meg se érkezik. De te tudod. Email esetén 2-3 másodperc az lófasz tejszínhabbal, nem lassulás.

Köszi. Egy kicsit el voltam tévedve.
Nem csak java-ból kellett küldenem, hanem shell-ből is.

Átállítottam az smtp-t a gmail-re, így már tökéletesen megy! :-)
Igaz, hogy kb. annyival később jön meg, mint régebben a felületi késleltetés, de ez már nem jelenik meg a felhasználói felületen! :-)

Megint nem lehet a freemailre kuldeni, meg annyit sem, hogy tesztlevel
status=bounced (host[] said: 550 5.7.1 Message denied by policy. gggruggvucftvghtrhhoucdtuddrgedtkedruddvgdduudekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuggftfghnshhusghstghrihgsvgdpucfhtffggffotefknfenuceurghilhhouhhtmecufedttdenucgoufhprghmkfhppfgvthifohhrkhculdduhedtmdenjfgrmhfjvggruggvrhfhihgvlhguucfjvggruggvrhcuufgtohhrihhnghculddquddtmdenucfjughrpefhtgfgggfufffkfhfvofesrgejmherhhdtjeenucfhrhhomhepifpnnhgunphrnhorpgevshgrsghipgfirggsrhhivghllhgruceoghhonhguohhrnhgvrdgtshgrsghirdhgrggsrhhivghllhgrsehvmhhkohhrhhgriidrhhhuqeenucfkphepledurdekvddrvddtvddrvdekpdeivddrudeihedrvdehfedrvddtfeenucfrrghrrghmpehhvghlohepmhgrihhlvddrvhhmkhhorhhhrgiirdhhuhdpihhnvghtpeeluddrkedvrddvtddvrddvkedpmhgrihhlfhhrohhmpehgohhnughorhhnvgdrtghsrggsihdrghgrsghrihgvlhhlrgesvhhmkhhorhhhrgiirdhhuhdprhgtphhtthhopehgohhnughorhgvkhesfhhrvggvmhgrihhlrdhhuhenucevlhhushhtvghrufhiiigvpedt

ip vagy domain blocked jo hir a listazott domainrol meg a supportnak sem tudsz irni mert onnan is visszavagja majd :D
Legalabbis regen igy oldottak meg ,hogy ne legyen sok munkajuk...

Csak felve teszem fel a kerdest:

Minek szopatod magad?

Csak félve válaszolok: nekünk pl. van kb. 1500 felhasználónk freemail-es címmel. Én nem tilthatom meg, hogy ezzel dolgozzon. És a többségnek nem lehet megmagyarázni, hogy időnként azért nem kap levelet (míg a kollégája igen), mert a rendszer egy idő után megunja, hogy mi szeretnénk mind az 1500-nak üzenetet küldeni.

Egy-két mondatban leírnátok, hogy lehet ellopni egy bitcoin-t?

Akkor tovabbi jo szorakozast :)

hogy is van az a vadaszos sztori a medvevel? :-)

"dolgozni mar reg nem akarok" - HZuid_7086 'iddqd' zoli berserk mode-ba kapcsol

Szerintem a freemail hülyesége sehol nincs egyes (állami) intézmények "érdekesen" konfigurált levelező-szervereitől. Ma az egyik szervezet 30 dolgozójának kiment levélből 29 pattant vissza valaki mástól címzett ismeretlennel. A 30-ik pedig mailbox is full-t adott vissza. Ezek konkrétan hivatalos adatbegyűjtés során küldött hivatalos címek voltak. Ehhez képest a freemail, citromail, vagy akár a (!) is jobban teljesít.

Egy-két mondatban leírnátok, hogy lehet ellopni egy bitcoin-t?

Én a (állami cég) nem tudok éppen levelet küldeni. 550-es hiba. Oszt találd ki, minek kellene megfelelni? (Vagy nem.)

régi címével próbáltad nszi ?
bár valszeg ugyan az lesz.

jo, hat ebben az orszagban mindig van lejjebb. Nalam az elbaszott levelezesnek a freemail, esetleg a citromail a mertekegysege...

"dolgozni mar reg nem akarok" - HZuid_7086 'iddqd' zoli berserk mode-ba kapcsol

Pedig minimum tájékoztatni illene őket, hogy a "fogadó rendszerek hektikus viselkedése késést vagy kimaradást" okozhat. Ajánlani néhány alternatívát, amivel nem szokott gond lenni.

Esetleg olyanban tudtok gondolkodni, hogy több IP-re elosztani a kimenő leveleket és érdemi szünetet iktatni közejük.



"After successfully ignoring Google, FAQ's, the board search and leaving a undecipherable post in the wrong sub-forum don't expect an intelligent reply."

A bl- ellenorzeseken tul vagyok (MXTB, sehol nincs listazva sem az ip sem a domain,
ezert kuldtem be.
Ebbol nekem az jon le, hogy teljesen hektikusan mukodik a freemail.
Egyebkent nem en, csak nehany felhasznalo akar oda kuldeni, jeleztek a hibat, hogy oldjam meg,
de ezek szerint eselytelen. A "freemail neha nem megy" es "nem hasznalunk fontos levelezesre freemailt, kozolje az ugyfelevel" tipusu konzerv tajekoztatas mar megvolt. :)

"Ebbol nekem az jon le, hogy teljesen hektikusan mukodik a freemail"

Az hogy mashol nem vagy listazva sosem erdekelte oket. Mindig is valami elbaszott unique szurojuk volt hol hazilag barkacsolva vagy esetenkent valami ceg bugos szarjat hasznalva. Azt hiszem mostanaban az utobbi a divat naluk.

Szerencsed van ,hogy egyaltalan most visszakaptal egy relative normalis hibauzenetet. Korabbi evekben meg arra sem forditottak energiat...

En 2004-ben kezdtem el veluk kuzdeni aztan valahol 2010-2011 kornyeken lett beloluk elegem es azota tiltolistan vannak. Sem freemail iranyba nem lehet kuldeni sem onnan nem fogadunk levelet. Szamomra nem leteznek mint szolgaltato.

Egyszer egyszer rajuk neztem kulonbozo projectek kapcsan aztan mindig oda jutottunk ,hogy jobb ha nem is tudunk egymasrol.

Es ez igy van jol. Mindenki happy.

"aztan valahol 2010-2011 kornyeken lett beloluk elegem es azota tiltolistan vannak.
...aztan mindig oda jutottunk ,hogy jobb ha nem is tudunk egymasrol."


na meg én így vagyok viktorékkal is :D


"After successfully ignoring Google, FAQ's, the board search and leaving a undecipherable post in the wrong sub-forum don't expect an intelligent reply."